SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013936 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013936
Domain Number 1 Region: 257-323
Classification Level Classification E-value
Superfamily Homeodomain-like 3.12e-20
Family Homeodomain 0.0023
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000196
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 47-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000268
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013936
Domain Number - Region: 141-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00159
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013936   Gene: ENSMPUG00000014042   Transcript: ENSMPUT00000014157
Sequence length 406
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:9889501:9908836:-1 gene:ENSMPUG00000014042 transcript:ENSMPUT00000014157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKI
SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHL
GISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAH
FNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAY
NAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA
QKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTEAALQTGTPSGPASELSNASLSP
SSTPTTLTDLTSPALPTVTSVLTSVPGNLEGHEPHSPSQTTLTNLF
Download sequence
Identical sequences D2HDG3 E2RPC3 M3YRH7
ENSMPUP00000013936 ENSMPUP00000013936 ENSCAFP00000029999 XP_002920044.1.58354 XP_004757403.1.14098 XP_019276729.1.44245 XP_019514378.1.44202 XP_863668.2.84170 ENSCAFP00000029999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]