SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014022 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014022
Domain Number 1 Region: 125-172
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000183
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1237-1294
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000405
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 584-648
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 985-1044
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 291-343
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 725-778
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 7 Region: 1364-1428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000068
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 648-720
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000085
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 9 Region: 1115-1170
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 10 Region: 1292-1343
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000458
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Domain Number 11 Region: 1043-1114
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000497
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014022
Domain Number - Region: 351-402
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000127
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Domain Number - Region: 856-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000127
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number - Region: 462-527
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00051
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number - Region: 1172-1221
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00051
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 911-984
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00196
Family TSP-1 type 1 repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014022   Gene: ENSMPUG00000014130   Transcript: ENSMPUT00000014245
Sequence length 1611
Comment pep:known scaffold:MusPutFur1.0:GL896907.1:26237622:26497626:1 gene:ENSMPUG00000014130 transcript:ENSMPUT00000014245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDECGPGGIQTRAVWCAHVEGWTTLHTNCKPAERPSNQQICFKVCDWHKELYDWSLGPW
NQCQPVISKSLEKPLECIKGEEGIQVREIMCIQKEKDIPAEDIICEYFEPKPLLEQACLI
PCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQVCQSSPCEEE
ENMYSLHVGPWSSCSMPHSRQVRQARRRGKNKEREKDRGKGVKDPEARELIKKKRNRNRQ
NRQENKYWDIQIGYQTREVMCTNKTGKAADLSFCRQEKLPMTFQSCVITKECQVSEWSEW
SPCSKTCYDTASPKGTRVRTRIIRQFPVGSEKECPELEEKEPCASQGDAVVPCPTYGWRT
TEWTECCVDPLLSQQDKRRGNQTALCGGGVQTREVYCVQANEDLLSHLNTHKDKEESKYQ
STSKSSAAPFLSITFEITASKPVDLNSCTGPVPNTTQLCHIPCPVECEVSPWSAWGPCTF
ENCNDQQGKKGFKLRKRRITNEPTGGSGGTGNCPHLLEAIPCEEPSCYDWKAVRLGDCEP
DNGKECGPGTQVQEVVCINSDGEEVDRQLCRDAIFPIPVACYAPCPKDCVLSMWSLWSSC
SHTCSGKTTEGKQIRARSILAYAGEEGGAHCPNSSALQEVRGCNEHACTVYHWQTGPWGQ
CIEDTSVSSFNTTTTWNGEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLL
PCRKDCLVTPYSDWTSCPTSCKEGDSGVRKQSRHRVIIQLPANGGRDCPDPLYEEKVCEA
PPVCQSYRWKTHKWRRCQLVPWSVRQDSPGAQEGCGPGRQARAITCRKQDGGQAGIHECL
WYAGPVPALTQPCQIPCQDDCQFTSWSKFSSCNGDCGAVRTRKRTIVGKSKKKEKCKNSQ
LYPLIETQYCPCDKYNAQPVGNWSDCILPEGKAELLLGVKTQGDTKECGQGYRYQAMACY
DQNGQLVETSRCNSHGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKP
YNGGRPCPKLDHVNQAQVYEVVPCHSDCSQYIWVSEPWSICKVTFVNMRDNCGEGVQTRK
VRCMQNTADGPSDHVEDYLCDPEEMPLGSRECKLPCPEDCVISEWGPWTRCTLPCSQSSF
RQRSADPIRQPADEGRACPNAVEKEPCNLNKNCFHYDYNVTDWSTCQLSEKAVCGNGIKT
RMLDCVRSDGKSVDLKYCEELGLEKNWPMNTSCMVECPVNCQLSDWSPWSECSQTCGLTG
KMVRRRTVTQPFQGDGRPCPALMEQSKPCPVKPCYQWQYGQWSLCQVQDAQCGEGTRTRN
ISCVVTDGSADDFSKVVDEEFCTDIEPIIDGNKKMVLEETCTQPCPGDCYLKDWSSWSLC
QLTCVNGEDLGFGGIQVRSRAVIIQELENQHLCPEQMLETKSCNDGQCYEYKWMASAWKG
SSRTVWCQRSDGINVTGGCLVVRQPDADRSCNPPCSQPHSYCSEMRTCSCEEGYTEVMSS
NGTLEQCTLIPVVVIPTVEDKRGDVKTSRAVHPTQSSSNPTGRGRTWFLQPFGPDGRLKT
WVYGVAAGAFVLLIFIVSMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences M3YRR2
ENSMPUP00000014022 ENSMPUP00000014022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]