SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014046 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014046
Domain Number 1 Region: 134-209
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000186
Family I set domains 0.069
Further Details:      
 
Domain Number 2 Region: 28-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000234
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014046   Gene: ENSMPUG00000014153   Transcript: ENSMPUT00000014269
Sequence length 341
Comment pep:novel scaffold:MusPutFur1.0:GL897121.1:2229432:2254206:-1 gene:ENSMPUG00000014153 transcript:ENSMPUT00000014269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQRYLWILLLCLQTCLGADRSDTDVVTLIGILGELVTFPLNIEKSQQVVNIVWNSETSV
AFITPGDAGAAPKVTVTHQNYKDRINVSSQNYNLEISNLRMEDSGIYKADINTKTFEGVF
TTTTRRFNLQVFRRLGKPQITQSLMTSLNSTCYVTLTCSVEKEEGNVTYSWSPLGETGNV
IRISRTPDSQELTYTCTAQNPISNSSDSISAQQLCADTATGLRSRRIGLLSGLAGLFLLI
LIVPLVLLFLLRKRGEGSFLKPFSKNSDAASKKTIYTYVMVTRAAPPAEGRIYDEIPPSK
ELPANEDPVNRVYATLQMEKMGKTSTQDGKPPGISAYENVV
Download sequence
Identical sequences M3YRT6
ENSMPUP00000014046 XP_004775934.1.14098 ENSMPUP00000014046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]