SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014047 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014047
Domain Number 1 Region: 307-467
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-46
Family MATH domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 194-312
Classification Level Classification E-value
Superfamily TRAF domain-like 4.38e-17
Family SIAH, seven in absentia homolog 0.013
Further Details:      
 
Domain Number 3 Region: 79-144
Classification Level Classification E-value
Superfamily TRAF domain-like 1.5e-16
Family SIAH, seven in absentia homolog 0.013
Further Details:      
 
Domain Number 4 Region: 9-76
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000928
Family RING finger domain, C3HC4 0.049
Further Details:      
 
Domain Number 5 Region: 139-193
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000719
Family SIAH, seven in absentia homolog 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014047   Gene: ENSMPUG00000014154   Transcript: ENSMPUT00000014270
Sequence length 470
Comment pep:known scaffold:MusPutFur1.0:GL896917.1:4258849:4267862:-1 gene:ENSMPUG00000014154 transcript:ENSMPUT00000014270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQSHLNACSFNVIPCPNRCPTK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAFESHEGVCPQESVYCENKCGARMMRRLL
AQHAASECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVPCPNQCGVGSVAREDLPGHLK
ESCSTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKILS
Download sequence
Identical sequences M3YRT7
ENSMPUP00000014047 XP_004747027.1.14098 ENSMPUP00000014047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]