SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014166 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014166
Domain Number 1 Region: 218-428
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.58e-52
Family Reprolysin-like 0.003
Further Details:      
 
Domain Number 2 Region: 519-575
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000929
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014166   Gene: ENSMPUG00000014274   Transcript: ENSMPUT00000014392
Sequence length 838
Comment pep:novel scaffold:MusPutFur1.0:GL897121.1:2654377:2663348:-1 gene:ENSMPUG00000014274 transcript:ENSMPUT00000014392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRTDWHPRRSLARCWLWGVHTRPMLPTVPNCRPVGQLLLLLLASLLPSARPASPLPREE
EIVFPEKLNGSVLPGSGAPARLLYRLPAFGETLLLELEQDPGVRVEGLTVQYLGQAPELL
GGAEPGTYLTGTVNGDPESVASLHWDGGALLGVLQYRGTELHIQPLEGGTLNSAGGPGAH
ILRRKSPASSQGPMCNVKAPPGNPSPSPRRAKRFASLSRFVETLVVADDKMAAFHGAGLK
RYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGPGEEGPQVGPSAAQTLRSFCAWQRGL
NTPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTA
AHELGHVFNMLHDNSKPCVGLNGPGSASRHVMAPVMAHVDPEEPWSPCSARFITDFLDNG
YGHCLLDKPAAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGH
AMCQTKHSPWADGTPCGPAQACMGGRCLHADQLQDFNIPQAGGWGPWGSWGDCSRSCGGG
VQFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTQDCPTGSALTFRDEQCAAFNHRTDLFKS
FPGPMDWVPRYTGVAPRDQCKLTCQARALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIH
AGCDRVIGSKKKFDKCMVCGGDGSSCSKQSGSFRKFRYGYNNVVTIPAGATHILVRQQGS
PGVRSLYLALKLPDGSYALNGEYTLMPSPTDVVLPGGVSLRYSGATAASETLAGHGPLAQ
PLTLQVLVAGNPQNARLRYSFFVPRPAPSTPRPPPQDWLHRKAQILEILRRRPWAGRK
Download sequence
Identical sequences M3YS56
ENSMPUP00000014166 XP_004775981.1.14098 ENSMPUP00000014166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]