SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014236 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014236
Domain Number 1 Region: 136-301
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.02e-68
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000285
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.22e-27
Family Canonical RBD 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014236   Gene: ENSMPUG00000014345   Transcript: ENSMPUT00000014464
Sequence length 302
Comment pep:known scaffold:MusPutFur1.0:GL896903.1:9113433:9127955:-1 gene:ENSMPUG00000014345 transcript:ENSMPUT00000014464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA
AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSE
PPKVETQEGEPKAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAAENFRCLCTHE
KGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIFGKKFDDENFILKHTGPGLLSMANS
GPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGE
YV
Download sequence
Identical sequences M3YSC6
ENSMPUP00000014236 ENSMPUP00000014236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]