SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014276 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014276
Domain Number 1 Region: 11-266
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-50
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 312-603
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.55e-36
Family Extended AAA-ATPase domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014276   Gene: ENSMPUG00000014384   Transcript: ENSMPUT00000014504
Sequence length 1145
Comment pep:known scaffold:MusPutFur1.0:GL896902.1:13681455:13773102:-1 gene:ENSMPUG00000014384 transcript:ENSMPUT00000014504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDQVTLVGQVFESYVSEYHKNDILLILKESDEDAHYPVVVNAMTLFETNMEIGEYFNA
FPNEVLTVFDSALRRSALTILQSLSQPEGASMKQNLHARISGLPVCPELVREHIPKTKDV
GHFLSVTGTVIRTSLVKILEFERDYMCNKCKHVFVVKADFEQYYTFCRPSSCPSLESCDS
SKFTCLSGLSSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTI
YGVVMQRWKPFQQDVRCEVEIVLKANYVQVNNEQSAGNIIDEEVQKEFEDFWESYKSDPF
AGRNEILASLCPQVFGMYLVKLAVALVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQ
FLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLK
EHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDTHESVSVNIALGSPLL
SRFDLILVLLDTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRNLQPTLSD
EGNQVLLRYYQMQRQSDSRNAARTTIRLLESLIRLAEAHARLMFHDAVTLEDAVTAVSVM
ESSMQGGALLGGVNALHTAFPENPLKQYQRQCELILEKLELNNLLSEELRRLERLQNQNV
HQSQPQAVEAETNPGSSKNDPGEAAKSRIWSAQQEVNWSMLTSSPGPSPEGSPLSDPLSH
GGPSRPAKRKHSAEHKNSKDDSLDWFDSIATHQLEPQNTVPVSPKTNGGKMALQTFKNKA
QGKEKGVPGQRSKMETGQLPAPGETEASRRPDHVDHVEGKEAKKAAVVPEAAGSAGEPDS
VLTHHVSRKLHQLRKASAQELCKNPATVPVQPVGPSLPRSSSLCGPKGALETSKRKRQKS
LAQMEEPELGSAESPGPPLAKLAKFTFKRKSKLTHSPEDHSPMSPGTTKGAVPSPRVLRR
VSREAVVPGKGPQKLASTSGSRNSDQQQDQAMDVSQQALEEDSPREKSKRGPEGRVTEPE
FELGNQTGRSPPTCQRDRKEDVSRNIKSSKVHACTLAKLAHFSFTSPSESKSEPPPPPES
ENEGARGTSPRPGAAATVFGRKRKTFQLEGSSERLFFSKKSLFTLSELDDEALDFDWNEE
IRRKP
Download sequence
Identical sequences M3YSG6
ENSMPUP00000014276 XP_004740148.1.14098 XP_004740149.1.14098 ENSMPUP00000014276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]