SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014308 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014308
Domain Number 1 Region: 31-98
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000144
Family SH3-domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014308
Domain Number - Region: 438-609,676-718
Classification Level Classification E-value
Superfamily ARM repeat 0.0307
Family PBS lyase HEAT-like repeat 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014308   Gene: ENSMPUG00000014415   Transcript: ENSMPUT00000014536
Sequence length 749
Comment pep:novel scaffold:MusPutFur1.0:GL896974.1:1852611:1867531:1 gene:ENSMPUG00000014415 transcript:ENSMPUT00000014536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHGPGRGDRGAPGLASWFRSPRRLHCPGAARPGPMYRALYAFRSAEPNALAFAAGETFL
VLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNAAMRDGGKY
SLEQRGVLQKLIHHRKETLSRRGPSASSPSTMTPSTSDHHLDAAAARQPNGMCRAGFERQ
HSLPSSEYLGADGGLYQIPPQPRRAAPTTPPPPVKRRDREALMAPGSGGRNTAPSGGSSV
SSGSSVSSTSLDTLCTGSSSSELGPSCSPTPPPVPRRGTHTTVSQAQPPPSKAPAPEPPT
EEVAVDTASAPDELEALGALSLGTTDEKAVAEPAVPRTIGAELMELVRRNTGLSHELCRV
AIGVVVGHIQASVPASSPVMEQVLLSLVEGKDLSTALPSGQVCHDQQRLEVIFADLARRK
DDAQQRSWALYEDEGVIRCYLEELLHILTDADPEVCKKMCKRNEFESVLALVAYYQMEHR
ASLRLLLLKCFGAMCGLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFS
MGEAVPYAHYEHLGTPFAQFLLSIVEDGLPLDTTEQLPDLCMNLLLALNLHLPAPDQNVI
MTALSKHSNVKIFSEKLLLLLNRGDDPVRIFKHEPQPPHSILKFLQDVFASPATAAIFYH
TDMMALIDITVRHIADLSPGDKLRVEYLSLMHAVIRSTPYLQHRHRLPDLQATLRRILTE
EEASPQGQMDRMIVREMCKEFPELGEDPS
Download sequence
Identical sequences M3YSJ8
ENSMPUP00000014308 XP_004760764.1.14098 ENSMPUP00000014308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]