SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014360 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014360
Domain Number 1 Region: 88-141
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000518
Family Tudor domain 0.0000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014360   Gene: ENSMPUG00000014470   Transcript: ENSMPUT00000014591
Sequence length 282
Comment pep:novel scaffold:MusPutFur1.0:GL897005.1:1470036:1502965:1 gene:ENSMPUG00000014470 transcript:ENSMPUT00000014591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMGGGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDISEAS
DKPKGTPKRKPAKKNKSQKKNATTPLKQWKVGDKCSAIWSEDGCVYPATIASIDFKRETC
VVVYTGYGNREEQNMSDLLSPASEVANNVEQNAQENENESQISTDESENSSSRSPGNKPN
NIKSKAAPWNSFLPPPPPMPGSGLGPGKPGLKFSGPPPPPPPPHFLSCWLPPFPSGPPII
PPPPPICPDSFDDADALGSMLISWYMSGYHTGYYMVIQTVFS
Download sequence
Identical sequences M3YSQ0
ENSMPUP00000014360 XP_004764547.1.14098 XP_012917949.1.14098 ENSMPUP00000014360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]