SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014370 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014370
Domain Number 1 Region: 97-268
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.62e-52
Family CRAL/TRIO domain 0.000028
Further Details:      
 
Domain Number 2 Region: 6-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.03e-17
Family CRAL/TRIO N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014370   Gene: ENSMPUG00000014480   Transcript: ENSMPUT00000014601
Sequence length 327
Comment pep:novel scaffold:MusPutFur1.0:GL896902.1:17341763:17425965:1 gene:ENSMPUG00000014480 transcript:ENSMPUT00000014601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRA
RKFHHFEAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILV
LFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSML
RLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLI
HPEILPSEFGGMLPPYDMGTWARTLLDHEYDDDSEYNVDSYSMPMKEVEKELSPKSMKRS
QSVVDPTVLKRMDKNEEENMQPLLSLD
Download sequence
Identical sequences M3YSR0 U6CQU2
ENSMPUP00000014370 XP_004740176.1.14098 ENSMPUP00000014370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]