SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014449 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014449
Domain Number 1 Region: 583-631
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000392
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 2 Region: 663-726
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000594
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 35-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000102
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 155-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 717-773
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000324
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 6 Region: 96-144
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000536
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014449
Domain Number - Region: 363-424
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 0.087
Family MPP-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014449   Gene: ENSMPUG00000014559   Transcript: ENSMPUT00000014681
Sequence length 955
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:37590831:37650747:1 gene:ENSMPUG00000014559 transcript:ENSMPUT00000014681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLGKTRKGLRGFQGTAGHSVLYFILLSALIDKCQPCYCDHYPWSQWSSCSKSCNYGIQ
SRQRKIVVDEYYMNNYCDQICKKLETRECNWQHCPINCLLGDYGPWSDCDPCVEKQFKVR
SILRPGQFGGQPCTEPLVTFRPCIPSKLCKIEEVDCKNKFRCDSGRCIASKLECNGENDC
GDNSDERDCGRIKAVCPGKKQHLPIPSVQLMGAGYHFLAGEPRGEVLDNSFTGGICKTAK
SSKASNPYRVPANLENVNFEVKTEEDDFETDFYKDLIPLTSNKDRQSSSSGRHQEGVYVP
IFYSSKKTQSTTHKYAFKQAIEASHKKDSSFARIHKMIKVLNFTMKSKDLQLSDVFLKAL
NHLPLEYNYALYSRIFDDFGTHYFTSGSLGGVYDLLYQFSLEELKNSGLTEEEIQDCVRT
KKGSRIIETPKQKKQERTCETNNLNFLYDGSVLQGAEKSISLTRGGRSKYAAALVWERGT
SGPAEKEFSEWLESVKENPAVIDFELAPITDLVRNIPCAVTRRSNLKKAFREYAAKFDPC
RCAPCPNNGRPTLSGTECLCVCQSGTYGDNCERRSPDYKSNAVDGSWSCWSSWSACDATY
KRSRTRECNNPSPQLGGKNCEGEKQQEEHCTFSIMENDGQPCVSDDEDRKETDLPETESD
SGCPRPIPPENGFIRNEKKLYAVGEDVEISCFTGFTTVGYQYFRCLPDRTWRRGDVECQQ
TQCLKPVAQEGLTISPFQKFYEIGDSIELTCPKGFVVAGPSRYTCSEGSWTPHISDSLTC
EEVSDSLTKLKGHCQLGQKQVGSECICISPEEDCGHYSEDVCVFDTDTSRYFTSSSCKFL
AEKCLNNQQLHFLHIGSCQDGPQLEWGLERRRLSTNSTKKESCGYDTCYDWEKCSASTSK
CVCLLPPQCFKGGSHLYCVRIGSSTNEKTVNICEVGAVRCANRKMEILYPGRCSA
Download sequence
Identical sequences M3YSY9
ENSMPUP00000014449 ENSMPUP00000014449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]