SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014507 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014507
Domain Number 1 Region: 894-1203
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-109
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000011
Further Details:      
 
Domain Number 2 Region: 1161-1461
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.58e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000915
Further Details:      
 
Domain Number 3 Region: 33-191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-39
Family MAM domain 0.00000427
Further Details:      
 
Domain Number 4 Region: 392-589
Classification Level Classification E-value
Superfamily Fibronectin type III 6.89e-25
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 289-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000136
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 6 Region: 195-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000562
Family I set domains 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014507   Gene: ENSMPUG00000014617   Transcript: ENSMPUT00000014740
Sequence length 1463
Comment pep:known scaffold:MusPutFur1.0:GL896902.1:21984227:22547875:-1 gene:ENSMPUG00000014617 transcript:ENSMPUT00000014740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAAAALPVFVALLLLSPRSPLGSAQGQFSAGGCTFDDGLGACDYHQDLYDDFEWVHVS
AQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPG
TLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSTFWPNEYQVIFEAEVSGGRSGYIA
IDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQRRNGEDIPVA
QTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFAQLIVREPPRPIAPPQLL
GVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKLWHLDPDTEYEI
RVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARRIAVDWESLGYNITRCH
TFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEET
IIQTDEDVPGPVPVNSLQGTSFENKIFLNWKEPLDPNGVITQYEVSYSSIRSFDPAVPVA
GPPQTVSNLWNSTHHVFMHLHPGTTYQFLIRASTVKGFGPATAINVTTNISAPTLPDYEG
VDASLNETATTITVLLRPAQAKGAPISAYQIVVEELHPHRTKREAGAMECYQVPVTYQNA
LSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKET
KTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVVILIVKKRYIC
WRRHICIRNIRRSYYSYSYYLKLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDP
LSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHI
NLMKTSDSYGFKEEYESFFEGQSASWDVAKKDQNRAKNRYGNIIAYDHSRVILQPVEDDP
SSDYINANYIDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCY
KYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPDHGVPYH
ATGLLSFIRRVKFSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKA
LRSRRINMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDE
FQTLNSVTPRLQAEDCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMD
SYRQPAAFIVTQYPLPNTVKDFWRLVYDYGCTSIVMLNEVDLSQGCPQYWPEEGMLRYGP
IQVECMSCSMDCDVINRIFRICNLTRPQEGYLMVQQFQYLGWASHREVPGSKRSFLKLIL
QVEKWQEECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRNSKP
NMVEAPEQYRFCYDVALEYLESS
Download sequence
Identical sequences M3YT47
ENSMPUP00000014507 ENSMPUP00000014507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]