SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014516 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014516
Domain Number 1 Region: 362-440
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.05e-20
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 127-162
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000225
Family Intermediate filament protein, coiled coil region 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014516
Domain Number - Region: 203-275
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000837
Family Myosin rod fragments 0.013
Further Details:      
 
Domain Number - Region: 244-360
Classification Level Classification E-value
Superfamily Prefoldin 0.00112
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014516   Gene: ENSMPUG00000014625   Transcript: ENSMPUT00000014749
Sequence length 497
Comment pep:novel scaffold:MusPutFur1.0:GL897006.1:244312:250088:1 gene:ENSMPUG00000014625 transcript:ENSMPUT00000014749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDLSSNMMSLSVRTSGLPRRLSSQSGTSGRARGTSASLVGSSYGGSTFGFGDSCGGGFSA
ASMFGSSSGFGGGSGTSLAGGLGTAYGGTLGGLGGGFGGLGIGFGGSPGGSGAVGILSGN
DGGLLSGSEKETMQNLNDRLASYLDKVRALEAANTELENKIREWYETRGSGTGDSGSQND
YSKYYPLIEDLRNEIISASIGNAQLILQIDNARLAAEDFRMKYENELALHQSVEADINGL
RRVLDELTLARADLEMQIENLTEELAYLKKNHEEELQSFRAGGPGEISVEMDAAPAVDLT
RLLNNMREQYETIAEQNRKDAEAWFIEKSGELRKEISSNTEQLQSSKSEVTDLRRAVQNL
EIELQSQLATKKSLEVSLAEVEGDYCGQLSQVQQLISSLEEQLLQVRADTEHQNADHQRL
LDAKARLELEIETYRRLLDGEAQRDGFDETLYVTESKPQTQSIGSSKDQTKSRKIKTIVQ
EVVNGEVVSSQVQEELM
Download sequence
Identical sequences M3YT56
ENSMPUP00000014516 ENSMPUP00000014516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]