SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014533 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014533
Domain Number 1 Region: 311-389
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.23e-21
Family Intermediate filament protein, coiled coil region 0.00087
Further Details:      
 
Domain Number 2 Region: 77-112
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000371
Family Intermediate filament protein, coiled coil region 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014533
Domain Number - Region: 194-315
Classification Level Classification E-value
Superfamily Prefoldin 0.0471
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014533   Gene: ENSMPUG00000014642   Transcript: ENSMPUT00000014766
Sequence length 465
Comment pep:novel scaffold:MusPutFur1.0:GL897006.1:332332:338466:1 gene:ENSMPUG00000014642 transcript:ENSMPUT00000014766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFQLSSASRRVCSRAGPGRLSGGGPGFGAGNVYRGSGAGSSFSCTLGNISSGGGFCNGG
GGVCAGFLGNECGLLSGNEKVTMQNLNDRLACYLDQVRALEEANVDLEQKIKAWYEKYGP
GSCRGLDHDYTRYFSVIEDLKRQIISATTCNSSIALQNDNARLTADDFRLKYENELALHQ
SVEADINGLHRVMDELTLCTADLEIQFETLSEELAYLKKNHEEEMKVLQCAAGGDVNVEV
NAAPSVDLTVLLNNMRAEYEDLAEQNRRDVEAWFNEKSASLQQQISDDAGAATTARNELT
ELKRSLQTLEIELQSIVAMKHSYECSLAETEGNYCLQLQQIQDQIGAMEEELQQIRTETE
GQKLEYEQLLDIKIFLEKEIETYCKLIDGEERRKGKPVCPRSKGRGPIHSENQVQDSKEE
ILVKTVVEELDQLGNVLSLRVHSVEEKSSKISNITMEQRIPSKAP
Download sequence
Identical sequences M3YT73
ENSMPUP00000014533 ENSMPUP00000014533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]