SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014544 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014544
Domain Number 1 Region: 377-455
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.15e-23
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 142-177
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000033
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 259-375
Classification Level Classification E-value
Superfamily Prefoldin 0.0000207
Family Prefoldin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014544   Gene: ENSMPUG00000014653   Transcript: ENSMPUT00000014777
Sequence length 529
Comment pep:novel scaffold:MusPutFur1.0:GL897006.1:370193:374904:1 gene:ENSMPUG00000014653 transcript:ENSMPUT00000014777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCSSRVSSSRAGSSGMVRVSAGGSSFSSGSRCGLGGGSARGFRGGTGSCGLSGGSTSGF
GGSFGGGFGSCSGGGGLGGTAGSGAGFGGGSGFGGGSGFGGGSGFGGGSGIGGGASGGFY
SCGGGMGGGMGGGVGDGGLFSGGEKQTMQNLNDRLASYLDKVRALEEANTDLENKIREWY
EKFGPGSGDGGSGKDYSKYYPVIEDLRNQIITATIENAGIVLQIDNARLAADDFRMKYEN
ELYLRQAVEADINGLRKVLDDLTMTRSDLEMQIESLTEELAYLKKNHEEEMKSMQGSSGG
DVTVEMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEEQFNKQSASLQAQISTDAGAASS
AKNEITELKRTLQALEIELQSQMAMKSSLEGTLADTEAGYMAQLSEIQMKISSLEEQICQ
IRGETECQNAEYEQLLNIKTRLEMEIETYRRLLDGEGGGCGSGGSDLRNSGSRSTGSRNM
GSGDSRSGSCSGQGRDPNKTRVTKTIVEEVVDGKVISSQVSNVSEVKVK
Download sequence
Identical sequences M3YT84
ENSMPUP00000014544 ENSMPUP00000014544 XP_004764641.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]