SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014595 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014595
Domain Number 1 Region: 32-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000581
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 95-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000003
Family Fibronectin type I module 0.018
Further Details:      
 
Domain Number 3 Region: 198-242
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000109
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014595   Gene: ENSMPUG00000014704   Transcript: ENSMPUT00000014828
Sequence length 349
Comment pep:novel scaffold:MusPutFur1.0:GL896902.1:25698721:25702252:-1 gene:ENSMPUG00000014704 transcript:ENSMPUT00000014828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAPSSQTAARSAQTPTSGPSPRPCAGTAAPTPSQCAAAPAPSCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCVFGGTVYRSGESFQSSC
KYQCTCLDGAVGCVPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDHTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNAFCRLEKQSRLCMVR
PCGADLEESIKKGKKCIRTPKISKPVKFELSGCTSVKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences M3YTD5
ENSMPUP00000014595 ENSMPUP00000014595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]