SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014606 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014606
Domain Number 1 Region: 162-503
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-100
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000249
Further Details:      
 
Domain Number 2 Region: 21-150
Classification Level Classification E-value
Superfamily TRAF domain-like 9.81e-29
Family MATH domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014606   Gene: ENSMPUG00000014715   Transcript: ENSMPUT00000014839
Sequence length 1055
Comment pep:known scaffold:MusPutFur1.0:GL896925.1:8453885:8485613:1 gene:ENSMPUG00000014715 transcript:ENSMPUT00000014839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDGHNNTEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYP
DRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGF
SNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNS
LLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWET
LDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDY
YDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLM
RFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVV
YLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEV
LQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEE
KVKYTVFKVLKNSSLTEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKT
MIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYT
PISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIV
FQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVA
QRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITD
FENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSY
KIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDTENEMLVTVAHFHKEVFGTFGVPF
LLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQP
GNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
Download sequence
Identical sequences M3YTE6
ENSMPUP00000014606 ENSMPUP00000014606 XP_012910619.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]