SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014635 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014635
Domain Number 1 Region: 572-636
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000403
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 500-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000124
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 3 Region: 627-683
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000264
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000201
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014635
Domain Number - Region: 452-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0444
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014635   Gene: ENSMPUG00000014744   Transcript: ENSMPUT00000014868
Sequence length 844
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:37784123:37840133:-1 gene:ENSMPUG00000014744 transcript:ENSMPUT00000014868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVILLFILVGFIGEFQVFSRAASPVNCQWDSYASWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGSAFETQSCEPTLGCPVEEGCGERFRCFSGQCISKSLVCNGDSDCEEDGADEDRCE
DSQSRPSCDLDEPPPNIELTGNGYNELTGQFRKTVINTKSFSGQCRKVFSGDGKKFYRLS
GNILSYTFQVKINNDFNYEFYNSTWSYVKNTMTDYTSSSSKSHLFGSSSSGSYHSIPNYN
DNHKKKSYQLLVVQNSVEVAQFINNNPEFLQLAEPFWKELSFLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYKVLFYVNSDKIKESGLHSEDMKRCTSSGFNIFFASSSSQKCKTLENA
LKSDSGNKDHVMKGDSFVRGGSPNFVAGLSSLDLNNPAGNKKQYSSWAESVTGSPQVIKQ
KLTPLYELVKEVPCASVKRLYLKRALEEYLDEFDPCHCRPCQNGGIATIKGTQCQCHCKP
YTFGVACEQGVLVGNEAGGVDGGWSCWSSWSSCVQGKKTRSRECNNPPPREGGKSCIGEP
SESGPCEDEELQHLRLLEPHCFSLPLTPKEFCPSPPALKDGYVQDEGAKFPVGKNIKYTC
NEGYSLIGDPVARCGDDLRWLVGEMHCQKIACVLPTLMDGIQSHSRKPFYGVGEKVTISC
SGGMSLEGPSTFLCGSSLKWSPDMKGVRCVKKDAPLPPAVPECQRWEKLKNSRCVCKMPY
ECGSSLDVCAQDERSERILRLTVCKMRVLQCQGRNYTLAAGDSCTLPAPTEKACGACPLW
GKCDAQSGKCVCREASECEDGGFSVCVEVDGVEQTMSECAAGVLRCRGQDVTVTSTQPCA
GGTP
Download sequence
Identical sequences M3YTH5
ENSMPUP00000014635 XP_004738017.1.14098 ENSMPUP00000014635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]