SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014642 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014642
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-18
Family Caspase recruitment domain, CARD 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014642   Gene: ENSMPUG00000014751   Transcript: ENSMPUT00000014875
Sequence length 1058
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:37869679:37879492:-1 gene:ENSMPUG00000014751 transcript:ENSMPUT00000014875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESVPSELIERERKKLLEILQQDPDSVLDTLTSRRLVSEEEYETLENITDPLKKSRKL
LILVQKKGEVCCQHFLKCLLSTFPESATIWGLEHELLKHENIQPPQPIGVNKNSEDFFSS
GEKEPENPEITVSFTEKEHLDMGISESFGEKKTSHEETAWTSSEDEKEYNMPEVISSHSV
ENPEYEIPATIVYLQDGQRYEKPDDSLYLGREEYLESVGYSEDAEPAVEEEDYNDSEHRV
YDGEEGWTYSETLPFSEEEQSYEDSETGMSLEEEEGEEEEEEEEEEEKRIEERKNVFQDV
LSCLNMDRSRKLLPDVVKQFSLDRGCMWTPETPGDLAWNFLMKVQALDVTARDTVLRHKV
PDEDGKEELVTGVENLEIRDVQTIHPFDVLCASMLCSDSSLQREVMSNMYQCGFALPLLL
PDAENNKSILMLGAMKDIVKKWSTQSSGGPPGDTEKFLKMPVISFVRLGYCSFSKSRILN
RLLGPAQLKSHKIFLHQDFTVPVLPRQISDGLVEITWHFPERDCLKENPSFFQKPVALAN
LRGDLENFWTQFGFLVEISSAVFFFTDYLGEKEWDLLMFLGEAATERLYFVLSPQAQESE
EAQLFQRILKLKPSQLLFWEEEEAGERRKNMEGLQAALQEVMSSSLRCVTMEEMGSLARE
LGIQVDQDFENVQGIHSSSSENLAEDERQQRHGQPESSSESTAEMPVSGPGASWNLQNFH
PTPVLMPPQENSYPLPTRIGSNFNHMSLKAPWVMGSHFWSEQRTRWFRPWPFQKTRGYGR
GQSFRSQYFPPQRFYSPGRFIKFPRTSWGYCMDKTRPVSQHVQAWPKRPQEDRTMGALKR
SGAVVSHIGHFHSLGLQPAGTVGKPQPKQAYAQRTQPTRATGKPIKTTSHIEGLYPQAFQ
PAGAIQKPIRPAFQQGAKLKAQDVPSNPTFQMGSYPKSNSKCLPSSQFTSNQPKLFQVNQ
SQPVPSQPKPRHTKPTHPPPSQAKPSPPKPTQPKPYPPQASQSKPSQPRPAQPKPCSPQA
SQSKPSQPRTTQPKSCRTSPSQAKTNNLRAAPKRAGKR
Download sequence
Identical sequences M3YTI2
ENSMPUP00000014642 XP_004738018.1.14098 XP_012907035.1.14098 ENSMPUP00000014642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]