SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014660 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014660
Domain Number 1 Region: 483-645
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.9e-65
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000399
Further Details:      
 
Domain Number 2 Region: 87-322,353-390,420-430
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.66e-34
Family WD40-repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014660   Gene: ENSMPUG00000014769   Transcript: ENSMPUT00000014893
Sequence length 646
Comment pep:known scaffold:MusPutFur1.0:GL897005.1:5102966:5124743:-1 gene:ENSMPUG00000014769 transcript:ENSMPUT00000014893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEGGSDSQLRRRRRRDPEEPEKTELSERELTVVVAVAQENEEENEERWVGPLPVEATL
AKKRKVLEFERVYLENLPSASMYERSYMHRDVITHVVCTKTDFIITASHDGHVKFWKKIE
EGIEFVKHFRSHLGVIESIAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQC
EWIYCPGDAISSVAASEKSTGKIFIYDGRGDNQPLHIFDKLHTSPLTQIRLNAVYKAIVS
SDKSGMIEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSICFSPDGKKIATIGS
DRKVRIFRFLTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVRLIN
IVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIE
MKASENPVLQNIQADPTIVCTSFKKNRFYMFTKREPEDTKSADSDRDVFNEKPSKEEVMA
ATQAEGPKRVSDSAIIHTSMGDIHIKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGF
MIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTP
WLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITVK
Download sequence
Identical sequences M3YTK0
ENSMPUP00000014660 ENSMPUP00000014660 XP_004764604.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]