SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014667 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014667
Domain Number 1 Region: 247-467
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.39e-58
Family Reprolysin-like 0.0005
Further Details:      
 
Domain Number 2 Region: 556-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000314
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 843-899
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 903-959
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 1017-1068
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 962-1017
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014667   Gene: ENSMPUG00000014776   Transcript: ENSMPUT00000014900
Sequence length 1117
Comment pep:novel scaffold:MusPutFur1.0:GL897005.1:5190926:5479907:1 gene:ENSMPUG00000014776 transcript:ENSMPUT00000014900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEILWKTLTWILSLIMASSEFHSDHRLSYSSQEEFLTYLEHYQLTIPIRVDQNGAFLSFT
VKNDKHSRRRRSMDPIDPQQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDG
PQWKHDFLDNCHYTGYLQDQRSTTKVALSNCIGLHGVIATEDEEYFIEPLKNTTEDSTHF
SYENGHPHVIYKKSTLQQRHLYDHSHCGVSDLIRSGKPWWLNDTSTFPSSLPINGTHIRH
RQKRSVSIERFVETLVVADKMMVGYHGRKDIEHYILSVMNIVAKLYRDSSLGNVVNIIVA
RLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHHDNAVLITRYD
ICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGNSC
GTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAP
GQVYDADEQCRFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGNIEKG
WCYQGDCVPFGTWPQSIDGGWGPWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLGE
RKRYRSCNTDPCPLGARDFREKQCADFDNMPFRGKYYNWKPYTGGGVKPCALNCLAEGYN
FYTERAPAVIDGTQCNADSLDICINGECKHVGCDNILGSDAREDRCRVCGGDGSTCDAIE
GFFNDSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYINGAWTIDWPRKF
DVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPITRTGSGDNEV
GFSWNHQPWSECSTTCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTEPCP
PEWFIGDWLECSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPIEKESCNNQSCP
PQWVALDWSECTPKCGPGFKHRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPP
RWVTGDWGQCSAQCGLGQQMRTVQCLSYTGQASVDCPETVRPPSMQQCESKCDSTPISNT
EECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH
Download sequence
Identical sequences M3YTK7
ENSMPUP00000014667 ENSMPUP00000014667 XP_004764605.1.14098 XP_004764606.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]