SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014683 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014683
Domain Number 1 Region: 14-185
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.92e-61
Family Cyclophilin (peptidylprolyl isomerase) 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014683   Gene: ENSMPUG00000014792   Transcript: ENSMPUT00000014916
Sequence length 472
Comment pep:novel scaffold:MusPutFur1.0:GL897005.1:5593980:5787037:-1 gene:ENSMPUG00000014792 transcript:ENSMPUT00000014916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPG
FIVQGGDPTGTGTGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRA
DELNNKHTIFGKVTGDTVYNMLRLTEVDVDEDERPRNPHRIRSCEVLFNPFDDIIPREIK
KPKKEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDP
HLSSVPAVGSEKDDAVGESTNDGEYEGAEHDEYIDGDEKNLMRERIAKKLKKDASGNVKS
SGEGDVKKSVSRSDELRKEARQLKRELLAAKQKKVENAAKQAEKKSEEDETAPDDAVAEY
RREKQKYEALRKQQAKKGTSREDQTLALLNQFKSKLTQAIAETPENDVSEAEVEDDEGWM
SHVLQFEDKTRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR
Download sequence
Identical sequences M3YTM3 U6CT65
ENSMPUP00000014683 XP_004764613.1.14098 ENSMPUP00000014683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]