SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014684 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014684
Domain Number 1 Region: 103-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000101
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 41-88
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000209
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 3 Region: 514-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000529
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014684   Gene: ENSMPUG00000014793   Transcript: ENSMPUT00000014917
Sequence length 552
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:39035865:39083567:1 gene:ENSMPUG00000014793 transcript:ENSMPUT00000014917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFASQRFAFALCILEISLLTAEPTPSYGPQVVEDNEKPLPIDCRMSSWSEWSECDPCLRL
KFRSRSIEIFGQYDGKKCIEAVGDRQLCEPTEPCEDVEDDCGNDFKCGTGRCIKRRLLCN
GDNDCGDFSDEDDCEGDPRPPCRDRVVEESELGRTAGYGINILGMDPLTTPFDNEYYHGL
CDRIRDGNTRVYYRKPWNVASLAYETKADKNFRTESYEEQIEVFKAIVQETTSNINAEVT
LKFTPTEAIEKHKSTPEEGKSPHKNFFHPTEGGGKFGLTYSKNESYQSLLSRSSKTEKMF
LLVKGEIQLGRFVMRSRDVVLTQTFLDDLKALPSTYAKGEYFAFLETYGTHYSSSGSLGG
FYELIYVLDKASMKQKGVELSDVKRCLGFDLGFSLKAGVELEGNFNKDGCSKTGKGNSVN
MSRDGIIDKVISLIRGGTPKYAYELKEKLLKGAKTVDVTDFVNWATSLSDAPVLVNQKLS
PIHNLVPVHIKDAHLKKQNLERAIDDYIKEFNVAKCDPCKNGGTVILLDGQCLCSCPITF
SGIACEISKRVT
Download sequence
Identical sequences M3YTM4
ENSMPUP00000014684 ENSMPUP00000014684 XP_004738027.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]