SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014690 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014690
Domain Number 1 Region: 744-818
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-16
Family SH3-domain 0.0000109
Further Details:      
 
Domain Number 2 Region: 503-577
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000656
Family SH3-domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014690   Gene: ENSMPUG00000014799   Transcript: ENSMPUT00000014923
Sequence length 838
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:39159394:39255281:1 gene:ENSMPUG00000014799 transcript:ENSMPUT00000014923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTKADVKSLMAKFNAGGNPTEEVSVSNRPFKVTGQNSPSGVQARKNLFDNQGNASPPAGP
SNVPKFGSPKPPLAVKPPSEEKPDKEPKPPFLKPTGVGQRFGPQANSATRDPEVRVGFPK
PMGPKPVTVPKEDAKPVFPWPPGNKPSPHSVNQNHDLKPPGPKPGSHPLAPEAEQKQAFP
KLAGAKGKFVSASQDHDPKPLFPKPAFGQKPSLSIDDSHEDESPTKNVSLQKGPPAPLGA
KAKTGPLKPAREDQETKDLGGEMSSSPFSGVVLKPAANRGSPGLSRNAEEKKEERKIDAA
KNIFLNKMNQEEPAPGTPSAKFPKMPSKLATTGPWSQSQDKEKGDKNAATPKQKPLPSLF
ALGPPPPKPSRPPHVDLTKFRKATSGNSTSKGQTSYSTASLPPPPPPHPVSQPPLPTSHP
TQPPVPSLPPRNIKPPLDLKSPVNEENQDGVMHSDGPGNLDEEQDSEGETYEDIEASKER
EKKKEKEEKKRLELEKKEQKEREKKEQEIKKKFKLTGPIQVIHQATACCDVKGGKNELSF
KQGEQIEIIRITDNPEGKWLGRTARGSYGYIRTTAVQIDYDSLKRKKTSLGVLSSRPIED
DQEVYDDVAEQDDISSHSQSGSGDEGMFPPPPDDDIYDGIEEEDADDGSTLQVEDKSNSW
SWGILKMLKGKDDRKKSIREKPKVPESDNNEGSSFPSPPKQLDVGDEVYDDVDASDFPAP
PPELIQGAKAKTEEKDPKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVAPSFTSKRWGTR
DLQVKPGESLEVIQSTDDTKVLCRNEEGKYGYVLRSYLVDNDGEIYDDIADGCIYDND
Download sequence
Identical sequences M3YTN0
ENSMPUP00000014690 ENSMPUP00000014690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]