SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014750 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014750
Domain Number 1 Region: 19-127
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.34e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 323-368
Classification Level Classification E-value
Superfamily RING/U-box 0.00000102
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 259-296
Classification Level Classification E-value
Superfamily SAP domain 0.0000565
Family SAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014750   Gene: ENSMPUG00000014861   Transcript: ENSMPUT00000014985
Sequence length 374
Comment pep:known scaffold:MusPutFur1.0:GL896917.1:8764961:8781326:-1 gene:ENSMPUG00000014861 transcript:ENSMPUT00000014985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSPSSLAPDFIMWATCCNWFCLDGQPEEAPPAQGARTQAYSNPGYSSFPSPTGSEPSCKA
CGAHFANMARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRVRATAFQREELMKMKVKDL
RDYLSLHDVSTEMCREKEELVLLVLGQQPVISQEGRTRAPTLSPDFPEHQAFRTQPQAST
VPPTSARLPSSPAQATSVFPAQAQESQQANGHVSQDQEEPVYLESTARAPAEEETQSVDS
EDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQ
KGLQHLVCGAEDQNGGAVPPSVEENLCRICMDSPIDCVLLECGHMVTCTKCGKRMNECPI
CRQYVIRAVHVFRS
Download sequence
Identical sequences M3YTU0
ENSMPUP00000014750 ENSMPUP00000014750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]