SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014759 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014759
Domain Number 1 Region: 304-501
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.53e-48
Family CRAL/TRIO domain 0.000034
Further Details:      
 
Domain Number 2 Region: 224-303
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 9.94e-22
Family CRAL/TRIO N-terminal domain 0.0015
Further Details:      
 
Domain Number 3 Region: 509-667
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.22e-19
Family Supernatant protein factor (SPF), C-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014759   Gene: ENSMPUG00000014870   Transcript: ENSMPUT00000014994
Sequence length 695
Comment pep:novel scaffold:MusPutFur1.0:GL896925.1:11597579:11639010:-1 gene:ENSMPUG00000014870 transcript:ENSMPUT00000014994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKYQSPVRIYKYPFELVMAAYEKRFPTCPQIPVFLGSEVLRESRSPDGAIHVVERSCR
LRVEAPRLLRKIAGVEHVVFVQRNVLNWRERTLLIEAHNETFASRVVVNENCSYTVHPEN
EEWTCFEQSASLDIRSFFGFESALEKIAMKQYTANVKRGKEVIEHYLNELISQGTSHIPR
WTPAPVREEDARSQAGPRDAGSLQADRPGSTPGPAPETVLTEGDKLDADYIQRYLGHLTP
VQESCLIRLRHWLQETHKGKIPKDEHILRFLRARDFHLDKAREMLCQSLSWRKQHQVDLL
LQTWQPPALLEEFYAGGWHYQDIDGRPLYILRLGHMDTKGLMKAVGEETLLKHVLSVNEE
GQKRCEGNTKQFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLL
IVRAPRVFPVLWTLISPFINENTRQKFLIYSGSNYQGPGGLVDYLDKEVIPDFLGGECVC
NVPEGGLVPKSLYLMEEEQEHTDQLRQWRETYQSASVLRGAPHEVAVEILEGESVITWDF
DILRGDVVFSLYHSKQMPQSGRQEPGARAGGQLMDKGWVLGVDYSRVEAPLVCREGESIQ
GSHVTRWPGIYLLQWQMHSPPGNAACSLPGVEDVLTALHSPGPKCKLLYYYEVLASEDFR
GSMSSLESCTSGFSQLSATTSSSSGQSHSSPLVSR
Download sequence
Identical sequences M3YTU9
ENSMPUP00000014759 XP_004750496.1.14098 ENSMPUP00000014759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]