SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014829 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014829
Domain Number 1 Region: 382-643
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-80
Family Protein kinases, catalytic subunit 0.0000107
Further Details:      
 
Domain Number 2 Region: 65-142
Classification Level Classification E-value
Superfamily CAD & PB1 domains 8.83e-34
Family PB1 domain 0.0000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014829   Gene: ENSMPUG00000014940   Transcript: ENSMPUT00000015064
Sequence length 647
Comment pep:known scaffold:MusPutFur1.0:GL896922.1:14822885:14872857:-1 gene:ENSMPUG00000014940 transcript:ENSMPUT00000015064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDLVALQMSRRPRVPGYETMKNKDTGHPNRQKKHNSSSSALLKSPTLTTSSCAGAGEEK
KFLSDVRIKFEHNGERRIIPFSRPVRYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDD
LDKAIDILDRSSSMKSLRILLLSQDRNHTSPSPHSGVSRQVRIKASQSAGDVNTIYQPPE
PRSRHLSVSSQNPGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSEQCILDPLSS
AENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEFSDRETQLYDKGVKGGTYPRRY
HVSVHHKDYNEGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSAD
SENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDS
PETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYG
ALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM
SGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKI
ATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHFAQLVY
Download sequence
Identical sequences M3YU19
XP_004749255.1.14098 ENSMPUP00000014829 ENSMPUP00000014829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]