SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014956 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014956
Domain Number 1 Region: 139-225
Classification Level Classification E-value
Superfamily DEATH domain 1.38e-17
Family DEATH domain, DD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014956   Gene: ENSMPUG00000015067   Transcript: ENSMPUT00000015193
Sequence length 233
Comment pep:novel scaffold:MusPutFur1.0:GL896974.1:3234636:3236179:-1 gene:ENSMPUG00000015067 transcript:ENSMPUT00000015193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHNSSHREDMLHADKTRRVQDRNREEVWVGGALAPNTSSPFPPEPPGASGSIIPVYCAL
LATVVLGLLAYVAFKCWRSHKQRQQLAKARTAELGALDRDQRHGDSVVFLDNPPYRPSHL
TLLSPTPGPHPELGCRLYLHLSRQQQEEVERLLEVSGEPDKGWQGLASRLGYHADAVEIM
AQGQVPAHTLLRDWAVKEGSGATLRVLEDALAALGREDVVRLLSSPAEGCSVV
Download sequence
Identical sequences M3YUE6
ENSMPUP00000014956 ENSMPUP00000014956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]