SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014975 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014975
Domain Number 1 Region: 183-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-31
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 2 Region: 395-506
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 586-624
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 300-336
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 348-390
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 6 Region: 547-585
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 7 Region: 510-547
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000877
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014975   Gene: ENSMPUG00000015086   Transcript: ENSMPUT00000015212
Sequence length 995
Comment pep:known scaffold:MusPutFur1.0:GL897038.1:415788:491903:1 gene:ENSMPUG00000015086 transcript:ENSMPUT00000015212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGPGWRSVWRVAAPASLCGARPESRFRRPPRLAPVCAQPAPAPGKAARRXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPPPRSAQGAAGGSVAAASGPS
SSSSSISSSLPPSAVVMASRWSTKESPRWRSALVLLFLAGVYGNGALAEHSENVHISGVS
TACGETPEQIRAPSGIITSPGWPSEYPARINCSWFIRANPGEIITISFQDFDIQGSRRCS
LDWLTIETYKNIESYRACGSTVPPPYISSQDHVWIRFHSDDSISRKGFRLAYFSGKSEEP
SCACDQFRCGNGKCIPEAWKCNSMDECGDGSDEQVCAREADPPTAASFQPCAYNQFQCLS
RFTKVYTCLPESLKCDGNIDCLDLGDEIDCEMPTCGQWLKYFYGTFNSPNYPDFYPPGSN
CTWLIDTGDHRKVILRFTDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVV
SSSGQIRVHFCADKVNAARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNG
RDEINCTMCQKEEFPCSRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCV
FESWVCDSQDDCGDGSDEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMF
ERRSFETQLSRVEAELLRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRS
QLGFTSIRLPMAGRSGNIWNRIFNFARSRHSGSLALVSADGDEVVPSQSNSREPERSHTH
RSLFSVESDDTDTENERRDMAGASGGVAAPLPQKVPPTTAVEATVGASGSSSTQSTRGGH
TENGRDVTSVEPPGVSPARHQLTSALSRMTQGLRWVRFTLGRSSSVNQNQSPLRQLDNGA
HGREEDDDVEMLIPVSDGASDLDVNDCSRPLLDLASEQGQGFRQPYSATNPGGRPSNRDG
PCERCGIVHTAQIPDTCLEATLKQETSDDEALLLC
Download sequence
Identical sequences M3YUG5
ENSMPUP00000014975 ENSMPUP00000014975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]