SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015034 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015034
Domain Number 1 Region: 598-779
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-64
Family SPRY domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 5-87
Classification Level Classification E-value
Superfamily DEATH domain 9.53e-24
Family Pyrin domain, PYD 0.0032
Further Details:      
 
Domain Number 3 Region: 370-435
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.65e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015034   Gene: ENSMPUG00000015143   Transcript: ENSMPUT00000015271
Sequence length 785
Comment pep:known scaffold:MusPutFur1.0:GL896925.1:13065391:13078197:1 gene:ENSMPUG00000015143 transcript:ENSMPUT00000015271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKTPSDHLLDSLEELGDNDFEKFKFKLSIRLEKDHSRIPWGQLQNAKPVKLATLMITHY
GEENAARLTLQVLRAMNQNLLAEKLNRVIGPELLIQASGTDGSAMSCSSGENKPKGLKIP
DGLKGDRQRQNGDGVPGLPSSQQEAGRGPQKKPPGKQRDQKSSEGLDMLHKSRPRSMTLG
ARRSPLPSKPQGEKGSPSARLPRNANSLGRLQELDSGSHTGSLGRIKPKISEGHLPSGQK
RPRSLELNIFLGERETPKPETLLSQDKMRSDHPDSAAAPSEVATLDVGATVAPEKGSRNP
EHSMIWKPQDEAIYPPGRAQERDDSCRYSIASRESKTSGKCSSSSLMHLASLTVNNSEDY
KQQEGLHMANLSPKSLPQCERHMKQVQLLFCEDHREPICLICSLSQEHRGHQVRPIEEAA
LEYKEQIQKQLEHLKALRKSGEEQRSQGDKKTAKLLKQTETQKQRLQHQLEQLYHHLQQQ
EKLFVASLEDLSQTIGQVREKYSTQVSRDIAHLDKLIGDLEAKQSQPEWQLMQDIGVTLH
RVKIATVPKPWYTPPEVEKKIHLIYQKSEFMEKSMKSFRETLRSEMDIFNIPELICAQAH
AVNVILDTETAHPNLIFSNNLKSVRLGNKWNRLPDNPERFDSCTIALGLPSFLSGRHYWE
VEVGNKTGWILGICKASASRKGTMTLSANNGYWVVMMMKRNEYQVSTIPPTRLQIREAPK
RVGIFLDYMAGDISFYNVTYKSLIYTFTSFSFSGALQPMFSPGIHDGGKNMDPLTICPMA
DQRPQ
Download sequence
Identical sequences M3YUM4
ENSMPUP00000015034 ENSMPUP00000015034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]