SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015039 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015039
Domain Number 1 Region: 948-1230
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.44e-57
Family Patatin 0.055
Further Details:      
 
Domain Number 2 Region: 164-302
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.42e-22
Family cAMP-binding domain 0.022
Further Details:      
 
Domain Number 3 Region: 610-725
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-21
Family cAMP-binding domain 0.0078
Further Details:      
 
Domain Number 4 Region: 494-615
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-19
Family cAMP-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015039   Gene: ENSMPUG00000015148   Transcript: ENSMPUT00000015276
Sequence length 1354
Comment pep:known scaffold:MusPutFur1.0:GL897270.1:263881:321313:-1 gene:ENSMPUG00000015148 transcript:ENSMPUT00000015276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQEEDASPEADFCLGSALQSWSLQLPEQHSQSTMLMGIVIGALLALALVGVTVFFVYRR
VSQVRQVQPTPQYRFRKRDKVMFYGRKIMRKVTTLPHTLVGSTAMPRQRVRKRTKVLSLA
KRILRFKKEYPALQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHMVFVQLLEGEHVFQPGEPDTSIYVVQDGRLEVCIQDADGAEVAVKEVLAGDSVHS
LLSILDVITGHTAPYKTVSARAAVPSTVLRLPAVAFQGVFEKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAIPLVSVASVAAGKAKRQPCCGPEDRLERPLWPQETCD
PADRGGSRAAGSGPPLKRSRSFPLPSVHEESLDELGEARAGDQMPFVPPGNIAGATSDLR
MACDRARVLLQAEECPGSAMASKSKRNVTVADAPSAVFHYSETNSDETVCSRKTDAIFRA
AKKDLLTLMKLDDPSLLDDRVSLLHVPGGTVVSRQGDQDVNILFVVSGLLHVYQRKIDSE
EDTCLFVVRPGEMAGQLAVLTGEPLTFTIKANRDCSFLSISKAHFYEIMRKQPTVVLGVA
HTVVKRVSSFVRQMDFALDWMEVEAGRAVYRQGDKSDCTYIVLSGRLRSVTHKDDGKKRL
AGEYGRGDLIGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLG
EKILGSLQQGTATGHQFGLHAAGSKWDSGNPASNLSTVAVMPVSEDVPLTAFALELKHAL
SAIGPVLLLASDNVKQRLGSAALDSIHEYRLSSWLGQQEDIHRIVLYQADSTLTPWTQRC
IRQADCILIVGLGEQPTSGGQLERMLESTAMRAQKQLILLHREDGPAPSRTVEWLNMRSW
CSGHLHLCCPRRVFSRRSLPKLVEMYQRVFQRPPDRHSDFSRLARVLTGNAIALVLGGGG
ARGCAQVGIIRALTDCGIPVDMVGGTSIGAFMGALYAEERNYSQIRIRAKQWAEDMTSVV
KTVLDLTYPITSMFSGAGFNSSICSVFKDRQIEDLWIPYFAITTDITASAMRVHTDGSLW
RYVRASMSLSGYMPPLCDPRDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSQDETDL
TNYGDALSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVKNSEYCEYLRPP
IDGYGTLDFGKFDEICEVGYQHGRTVFDIWGRSGVLEKMLQDRQGPRKMKACDVLTCPNA
SFTDLAEIVSRIEPAKAATVDDESDYQTEYEEELPDGPKDAYADFQSAPARAGSDSAHPH
PDVVLFASRTTSPPSSIETPIWLPRTAPGLLLPM
Download sequence
Identical sequences M3YUM9
ENSMPUP00000015039 ENSMPUP00000015039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]