SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015063 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015063
Domain Number 1 Region: 246-457
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.54e-58
Family Reprolysin-like 0.00048
Further Details:      
 
Domain Number 2 Region: 544-599
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000837
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 1478-1537
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000105
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 947-999
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 1368-1432
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Domain Number 6 Region: 829-885
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000068
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 1427-1480
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 8 Region: 880-943
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 9 Region: 1323-1373
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000772
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015063   Gene: ENSMPUG00000015172   Transcript: ENSMPUT00000015300
Sequence length 1600
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:43321324:43612580:1 gene:ENSMPUG00000015172 transcript:ENSMPUT00000015300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCAQRSWLANLSVVAYLLNFGVLCYGSQAQPGPVQFPDRRQEHFLKALPEYHVVAPVRV
DARGHFLSYGLHHPVTDNSRRKRDVDGSEDRVYYRISHEEKDLFFNLSVNQGFLSKSYIL
ERRYGNLSHVKMVASSAPPCHLRGTVLQQGASIGTAALSACQGLTGFFHLPHGDFFIEPV
KKHPLAEGEYHPHIIYRKPRQRPPEKEEPTCGLKDGLATSQKPERQREEWERSQWPRRSL
SRRSISKERWVETLVVADTKMIEYHGSDSVESYILTIMNMVTGLFHNPSIGNAIHIVVVR
LILLEEEEQGLKITHHAEKTLSSFCKWQKSINPKSDLNPAHHDVAVLLTRKDICAGVNRP
CETLGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDCEPEGRHPY
LMSRQLQYNPSPLTWSKCSKEYITRFLDRGWGFCLDDIPQKKGLKSKVIAPGVIYDVHHQ
CQLQYGPNATFCQEVENVCQTLWCSVKGFCRSKLDAAADGTRCGEKKWCMAGKCITVGKK
PESIPGGWGRWSPWSHCSRTCGAGAQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPCR
PDVPTFRQMQCSEFDTVPYKNELYHWFPVFNPAHPCELYCRPIDGQFSEKMLDAVIDGTP
CFEGGNSRNVCINGICKVVGCDYEIGSNATEDRCGVCLGDGSACQTVKKMFKQKEGSGYV
DIGLIPKGARDIRVMELEGAGNFLAIRSEDPQKYYLNGGFIIQWNGNYKLAGTTFQYDRK
GDLEKLMATGPTNESVWIQLLFQVTNPGIKYEYTIRKDGLDNDVGKLVYFWQYGHWTECS
VTCGTGVRRQTAHCVKKGHGMVKATFCDPETQPNGRQKKCYEKDCPPRWWAGEWEACSAT
CGPHGEKKRTVLCVQTTGSDEQALPAKDCQHLLKPKTLISCNRDILCPSDWTVGNWSECS
VSCGGGVRIRSVTCAKNHDEPCDVTRKPNSRALCGLQQCPSSRRVLKPHKDPIPSGRNLP
TSEPDPPQPIPPTPSSPRMLSTSTVPESMSTSTGAVSSPSPTTAAGQGDTDAKWWQNSSH
QTEPGSHYVLSTGSTSQPIPTSWSLSSQPNEGNVPNSHPGPTSEGDFFTTTVSGSDLPSS
GKPVTWQVTPFYNTLTKEPGIEIHSGSGEDSEQSEIKNENNSVTWTEIRVAGKDASVVRS
TEIPLGPPPTPYLRGASLWPPFSTVMEDLLPSHRPATLKNGTPGAEVITEKPANTPFPLG
GDHQPAPTEHSVRHNPPELPGSVNLMQGSGPVLTKEDATSLIAEGFLLNASDYKELSTGG
SPAYWIAGNWSECSTSCGLGAYWRSVECSTGRDSDCAAVQKPDPAKRCHLRPCASWRVGN
WSKCSRNCSGGFQIREIQCVDSLDHRSLRPFHCQFLAGIRPPLSMSCNVEPCEEWQVEPW
NQCSRSCGGGVQERAVTCPGGLCDWKKRPTPTAPCNSHPCCHWVAGNWDLCTASCGGGFQ
KRTVHCVSSEDNTTEDQCLCDHEPKPPEFRKCGQEACKKRDDLLCSKDNLSTSFCQTLKT
MKKCSVPTVRAQCCLTCSQTHVVHTRRPRKPQSLKNPKAF
Download sequence
Identical sequences M3YUQ3
XP_004738116.1.14098 ENSMPUP00000015063 ENSMPUP00000015063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]