SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015146 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015146
Domain Number 1 Region: 153-261
Classification Level Classification E-value
Superfamily Cadherin-like 7e-26
Family Cadherin 0.00025
Further Details:      
 
Domain Number 2 Region: 262-377
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 373-495
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-24
Family Cadherin 0.0091
Further Details:      
 
Domain Number 4 Region: 482-587
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-18
Family Cadherin 0.0029
Further Details:      
 
Domain Number 5 Region: 78-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015146   Gene: ENSMPUG00000015255   Transcript: ENSMPUT00000015384
Sequence length 788
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:50657607:50832579:1 gene:ENSMPUG00000015255 transcript:ENSMPUT00000015384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIYQFLVLFLLWVCLPHFCSPEIMFRRTPVPQKRILGARVPRSDGKILHRQKRGWMWNQ
FFLLEEYTGSDYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDRE
EKAFYTLRAQAINRRTLRPVEPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVV
QVTATDADDPSYGNSARVIYSILQGQPYFSVEPETGIIRTALPNMNRENREQYQVVIQAK
DMGGQMGGLSGTTTVNITLTDVNDNPPRFLQNTIHLRVLESSPVGTAIGSVKATDADTGK
NAEVEYRIIDGDGTDMFDIITEKDTQEGIITVKKPLDYESRRLYTLKVEAENTHVDPRFY
YLGPFKDTTIVKISVEDVDEPPIFSRSSYLFEVHEDIEVGTIIGTVMARDPDSASSPIRF
SLDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTVIAAEINNPKEMTRVAVFVRIL
DVNDNAPQFAVFYDTFVCENARPGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTVQDN
EDNTARILTRKNGFNRHEISTYLLPVVISDNDYPIQSSTGTLTIRVCACDSQGNMQSCSA
EALLLPAGLSTGALIAILLCIIILLVIVVLFAALKRQRKKEPLILSKEDIRDNIVSYNDE
GGGEEDTQAFDIGTLRNPAAIEDKKLRRDIIPETLFIPRRTPTAPDNTDVRDFINERLKE
HDLDPTAPPYDSLATYAYEGTDSVAESLSSLESGTTDGDQNYDYLREWGPRFNKLAEMYG
GGESDKDP
Download sequence
Identical sequences M3YUY6
ENSMPUP00000015146 ENSMPUP00000015146 XP_004738144.1.14098 XP_004738145.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]