SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015252 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015252
Domain Number 1 Region: 319-374
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000589
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 2 Region: 268-314
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000127
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 433-480
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000127
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 4 Region: 374-429
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.00066
Further Details:      
 
Domain Number 5 Region: 846-1037,1074-1143
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000128
Family Rhodopsin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015252   Gene: ENSMPUG00000015362   Transcript: ENSMPUT00000015491
Sequence length 1493
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:15882735:15911689:1 gene:ENSMPUG00000015362 transcript:ENSMPUT00000015491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPACPLLLSVILSLRLAAAFDPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENP
DPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLEAGRPEEEEEAAAGLELCGGSGPFTFLH
FDKNFVQLCLSAEPSEAPRLLAPAALAFRFVEVLLINNNNSSQFTCGVLCRWSEECGRAA
GRACGFAQPGCSCPGSVGVMYMDQRSTVLVNNMGEPTLVSMRTELPLLSPCHPLRVPGEE
PEEEPKVKTQWPRSADEPGLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYG
TLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACE
GPELQTKLCSMAACPVEGQWLEWGPWGPCSTSCANGTQQRSRKCSVAGPAWATCTGALTD
TRECSNLECPAADGKWGPWNAWSLCSKTCDTGWQRRFRMCQASGAQGYPCEGTGEEVKPC
SEKRCPAFHEMCRDEYVMLMTWKKAAAGEIIYNKCPPNASGSASRRCLLSAQGVAYWGLP
SFARCISHEYRYLYLSLREHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFSVDI
LRNVTDTFKRATYVPSADDVQRFFQVVSFMVDAENKEKWDDAQQVSPGSVHLLRVVEDFI
HLVGDALKAFQSSLIVTDNLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSEDRLFLP
KEVLSLSSPDPEESSSYFVIGAVLYRTLGLILPPPRPPLAVTSRVMTVTVRPPTQPPAEP
LITVELSYIINGTTDPHCASWDYSRADASSGDWDTESCQTLETQAAHTRCQCQHLSTFAV
LAQPPKDLTLELAGSPSVPLVIGCAVSCMALLTLLAIYAAFWRFIKSERSIILLNFCLSI
LASNILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRK
RFLCLGWGLPALVVAVSVGFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGI
IVFNKLMARDGISDKSKKQRAGSERCPWASLLLPCSACGAVPSPLLSSASARNAMASLWS
SCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVFNSAQGFVITAVHCFLRREVQDVVKCQ
MGVCRADESEDSPDSCKNGQLQILSDFEKDVDLACQTVLFKEVNTCNPSTITGTLSRLSL
DEDEEPKSCLVGPEGGLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLD
LTWLRPEPGSEGDYMVLPRRTLSLQPGSGGGAGEEPPRARPEGTPRRAAKTLPHPEGYPS
FLSVDHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQIPEPGERSRTMPRTVPGSTMKLG
SLERKKLRYSDLDFEKVMHTRKRHSELYHELNQKFHTFDRYRSQSTAKCLSQEKPSPGEH
PGLSQQRRHQSWSTFKSMTLGSLPPKPRERLGLHRAAAWEPAEPPDGDFQTEV
Download sequence
Identical sequences M3YV92
ENSMPUP00000015252 ENSMPUP00000015252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]