SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015274 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015274
Domain Number 1 Region: 336-421
Classification Level Classification E-value
Superfamily DEATH domain 1.68e-21
Family DEATH domain, DD 0.000011
Further Details:      
 
Domain Number 2 Region: 87-125
Classification Level Classification E-value
Superfamily TNF receptor-like 1.25e-16
Family TNF receptor-like 0.00014
Further Details:      
 
Domain Number 3 Region: 34-85
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000404
Family TNF receptor-like 0.0000785
Further Details:      
 
Domain Number 4 Region: 108-167
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000903
Family TNF receptor-like 0.00012
Further Details:      
 
Domain Number 5 Region: 168-191
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000848
Family TNF receptor-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015274   Gene: ENSMPUG00000015384   Transcript: ENSMPUT00000015513
Sequence length 429
Comment pep:known scaffold:MusPutFur1.0:GL897006.1:3881707:3903605:1 gene:ENSMPUG00000015384 transcript:ENSMPUT00000015513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAGASGSAMDGPRLLLLLLLLLGVSLGGAKEACLTGLYTHSGECCKACNLGEGVAQPCG
ANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDET
TGRCEACRVCEAGSGLVFSCQDRQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLR
ECTRWADAECEEIPGRWITRSTPSEGSDSTAPSTEEPEGPPEQDIIASTVTDAVTTVMGS
SQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPANQTPPPEG
EKLHSDSGISVDSQSLHDQQPHTQTAAGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDT
WRHLAGELGYQPEHIDSFTQEACPVRALLASWAAQDSATLDALLAALRRIQRADIVESLC
SESTATSPV
Download sequence
Identical sequences M3YVB4
ENSMPUP00000015274 ENSMPUP00000015274 XP_004764844.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]