SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015301 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015301
Domain Number 1 Region: 387-669
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-68
Family WD40-repeat 0.0000244
Further Details:      
 
Domain Number 2 Region: 246-339
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000000647
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 
Domain Number 3 Region: 128-188
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000022
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 4 Region: 183-240
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000366
Family SIAH, seven in absentia homolog 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015301   Gene: ENSMPUG00000015411   Transcript: ENSMPUT00000015540
Sequence length 670
Comment pep:novel scaffold:MusPutFur1.0:GL896925.1:13868289:13880674:-1 gene:ENSMPUG00000015411 transcript:ENSMPUT00000015540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGKKARYNRFSGGPADLPAADATATTRMETTFGPAFSAVTTITKADGTSTYKQHRRTP
SSSSSLAYSPRDEEDSMPPISTPRRSDSAISVRSLHSESSMSLRSTFSLPEEEEEPEPLV
FAEQPSVKLCCQLCCGVFKDPVITTCGHTFCRRCALKSEKCPVDHAKLTVVVNNIAVAEQ
IGELFIHCRHGCRAAGSGKPPVFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCPNNPSCP
PLLKMNLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHE
MHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASM
LNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTI
KVWDTCTTYKCQKTLEGHDGIVLALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIRAHDN
PVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAAQSYLYSGSYQT
IKIWDIRTLDCIHVLQTSGGSVYSIAVTNHHIVCGTYENLIHVWDIESKEQVRTLTGHVG
TVYALAVISTPDQTKVFSASYDRSLRVWSMDNMICTQTLLRHQGSVTALAVSRGRLFSGA
VDSTVKVWTC
Download sequence
Identical sequences M3YVE1
XP_004750754.1.14098 XP_012910692.1.14098 XP_012910693.1.14098 ENSMPUP00000015301 ENSMPUP00000015301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]