SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015313 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015313
Domain Number 1 Region: 42-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.31e-62
Family Reprolysin-like 0.00094
Further Details:      
 
Domain Number 2 Region: 339-395
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000196
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 1207-1267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number 4 Region: 1315-1374
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000772
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 626-682
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000102
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 747-797
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000011
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 7 Region: 1158-1209
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000902
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 1264-1316
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 9 Region: 682-716
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015313   Gene: ENSMPUG00000015423   Transcript: ENSMPUT00000015552
Sequence length 1432
Comment pep:novel scaffold:MusPutFur1.0:GL896996.1:86781:119494:-1 gene:ENSMPUG00000015423 transcript:ENSMPUT00000015552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGTCGVQASAEPEARRERWEQRQEGRRQPRPRRLHQRSVSREKWVETLVVADPKMVEY
HGQPQVESYVLTIMNMVAGLFHDPSIGNPIHITIVRLILLEDEEEDLKVTHHADNTLRSF
CRWQKSINMKGDAHPQHHDTAVLLTRKDLCVAMNQPCGTLGLAHVAGMCQPLYSCSISED
TGLPLAFTVAHELGHSFGIQHDGNGNDCEPVGKQPFIMSSQLLYDTVPLTWSQCSREYIT
RFLDRGWGLCLDDSPSKDIIDFPSVPPGVLYDVGHQCRLQYGAYSTFCDDMDNVCHTLWC
SVGTTCHSKLDAAVDGTRCGENKWCLNGECVPVSFRPEAVDGGWSGWSAWSVCSRSCGMG
VQSAERQCTQPVPKYKGKYCVGERKRFRLCGLQACPPGHPSFRQVQCSRFDAMPYKGRLY
TWVPVVNDVNPCELHCRPSNEYFAVKLRDAVVDGTPCYPGQPGHDLCINGICKNVGCDFK
IDSRAVEDRCGVCHGNGSTCHTVSRTFEESEGLGYVDVGLIPAGAREIRIEEVAEAANFL
ALRGEDPEKYFLNGGWTIQWAGIYRVAGTTFTYERIGNWENLTSAGPTLEPVWIQLLFQE
RNPGVRYEYTIQREADGPGQVEPPKFSWSYGPWTQCTVTCGTGVQRQSVHCTERQAGPVD
ERHCDPLSRPDDRQQKCNEEPCPARWWAGEWQQCSSSCGPGGLSRRAVLCIQSVGLDEQS
ALEPPACAHLPQPPAETPCNRHVPCPATWAVGDWSQCSATCGEATQHRSVFCTNNTGVPC
DEAQRPAAGAPCSLLPCPRGPDPEGSGSGSPSHELFNEIDFFPDRLASHPLRPSPFEPAG
MDNAIKEDPEPGPPGPVFVDDFYYDYNFINFHEDLSYGPFNEPDPDLAGAGDWTPPPLNS
PAESPTGTPLPASEPPGTAEEDARGDRTPAPWPSQAGRSLASPSEQAPGDPLVNFLPEED
TPTEAPDLGFPSWPWIPALIGGMETPAAPGGPNRLPGGEDGRSQPNPPRWQGANELSEDE
EEDLDPRTTSLPQGPADTKLWPPIGGAPSPPAPAALPATWGRAGPLEPGTPTPSAPWDLQ
TAAVPGTFLPVPTPGLEHPFWGLAPGPVGQPEGPGSEAPPSPVLLPAPAQDSSANSSRVP
EAEPLDPSLAEEGPPAGNASWEVGNWSECSTTCGLGAVWRSVRCSSGREDDCPPAGRPQP
ARRCHLRPCAAWRTGNWSKCSRSCGGGSSVRDVQCVDMRDLRPLRPFHCQLGRAKPPAHR
ACGLQPCLSWYTSSWRECSEACGGGEQQRLVTCPEPGLCEETLRPNSTRACNTHPCTQWV
VGPWGQCSAACGGGVQRRLVRCVNTQTGLPEEDSEQCGHEAWPESSQPCGAQDCELTEAP
RCERDRLSFGFCETLRLLGRCQLPAIRNQCCRSCPTPGDGAPSRGHQRVARR
Download sequence
Identical sequences M3YVF3
ENSMPUP00000015313 ENSMPUP00000015313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]