SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015352 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015352
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.62e-23
Family APC10-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015352   Gene: ENSMPUG00000015462   Transcript: ENSMPUT00000015591
Sequence length 143
Comment pep:novel scaffold:MusPutFur1.0:GL896974.1:5366858:5368447:1 gene:ENSMPUG00000015462 transcript:ENSMPUT00000015591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSLVCPETVSRVSSVLNRDTRQFGKKHLFDQNEETCWNSDQGPSQWVILEFPQRIRVS
QLQIQFQGGFSSRRGHLEGSQGSEALSKIVDFYPEDNNSLQTFPVPAAEVDQLKVTLEDA
TDFFGRVVIYHLRVLGERGTNRD
Download sequence
Identical sequences M3YVJ2
ENSMPUP00000015352 ENSMPUP00000015352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]