SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015435 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015435
Domain Number 1 Region: 79-179
Classification Level Classification E-value
Superfamily TRAF domain-like 1.96e-21
Family SIAH, seven in absentia homolog 0.0028
Further Details:      
 
Domain Number 2 Region: 5-88
Classification Level Classification E-value
Superfamily RING/U-box 7.9e-20
Family RING finger domain, C3HC4 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015435   Gene: ENSMPUG00000015546   Transcript: ENSMPUT00000015676
Sequence length 244
Comment pep:novel scaffold:MusPutFur1.0:GL896925.1:14048483:14050145:-1 gene:ENSMPUG00000015546 transcript:ENSMPUT00000015676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSGGYDLNLFASPPDCNFLCSVCHGVLKRPVRLPCSHIFCKKCILQWLARQKTCPCCRKE
VKWKKMVHVNKLRRTIGRLEVKCKNAEAGCLVTCPLAHRRGHQDSCPFEPTACPNEGCMA
RVPRGALAEHRQHCQRGAQKQCPLGCGATLGPAERAHHNCYRELRDAWNQRQQRSRILVL
GLLRRMRKVHRTTNLIRRQLAQLGDFLEEDNALLMGAPQGEAEATPEGSIGAEVGGPRAT
VPCK
Download sequence
Identical sequences M3YVS5
ENSMPUP00000015435 ENSMPUP00000015435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]