SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015687 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015687
Domain Number 1 Region: 140-301
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.54e-47
Family CRAL/TRIO domain 0.0000669
Further Details:      
 
Domain Number 2 Region: 45-131
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 8.24e-16
Family CRAL/TRIO N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015687   Gene: ENSMPUG00000015795   Transcript: ENSMPUT00000015928
Sequence length 317
Comment pep:novel scaffold:MusPutFur1.0:GL896996.1:5657799:5669485:1 gene:ENSMPUG00000015795 transcript:ENSMPUT00000015928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENVGTFRVVPEEEQELRAQLERLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETRE
EVVRELQELVQAEAASGQELARAVAERVQGRDSAFFLRFIRARKFDVGRAYELLRGYVNF
RLQYPELFDSLSPEAVRCTVEAGYPGVLSTRDKYGRVVMLFNIENWDAEEITFDEILQAY
CFILEKLLENEETQINGFCIIENFKGFTMQQAAGLRASDLRKMVDMLQDSFPARFKAVHF
IHQPWYFTTTYNMVKPFLKTKLLQRVYVHGDDLSGFFQEIDEDILPADFGGTLPKYDGKV
VAEKLFGPRGQAENTAF
Download sequence
Identical sequences M3YWH7
ENSMPUP00000015687 XP_004763820.1.14098 ENSMPUP00000015687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]