SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015700 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015700
Domain Number 1 Region: 3-175
Classification Level Classification E-value
Superfamily SET domain 0.0000000000000981
Family Histone lysine methyltransferases 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015700   Gene: ENSMPUG00000015808   Transcript: ENSMPUT00000015941
Sequence length 190
Comment pep:novel scaffold:MusPutFur1.0:GL896953.1:9508332:9739351:-1 gene:ENSMPUG00000015808 transcript:ENSMPUT00000015941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPKVEKFSTANRGNGLRALAQLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLM
RCSQCRVAKYCSAKCQKKAWPDHKRECKCLKNCKPRYPPDSVRLLGRVVFKLMEETPSES
EKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPSFDIFEAFAKVPV
NPGPECVIVL
Download sequence
Identical sequences M3YWJ0
ENSMPUP00000015700 ENSMPUP00000015700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]