SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015701 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015701
Domain Number 1 Region: 312-470
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000257
Further Details:      
 
Domain Number 2 Region: 150-310
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.73e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000074
Further Details:      
 
Domain Number 3 Region: 64-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000387
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 107-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000415
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015701   Gene: ENSMPUG00000015809   Transcript: ENSMPUT00000015942
Sequence length 470
Comment pep:known scaffold:MusPutFur1.0:GL896996.1:5851186:5874937:1 gene:ENSMPUG00000015809 transcript:ENSMPUT00000015942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKINVPERQLGEDHQAGAAMRAPQCAQLRPLLRRRCPHGMPRPRLLAALCGALLCASGL
FAASGDFCDSSQCLNGGTCILGQDNTPFYCLCPEGFTGLICNETEKGPCYPNPCRNEAEC
RVVDDSHRGDVFTEYVCMCRHGYTGVHCETICTMPLGMETGAIADSQISASSVHLGFMGL
QRWAPELARLHRTGIVNAWTASNYDKNPWIQVNLMRKMRVMGVVTQGASRAGSAEYLKTF
KVAYSNNGHKFQFIQGAEGTGDKIFVGNMDNSGLKVNLFDFPLEVQYVRLVPIICHRGCT
LRFELLGCEVNGCAEPLGMKDNSIPDRQITASSIYRTWGLNAFSWYPFYARLDKQGKFNA
WTAQTNDASEWLQIDLGSERQVAGIITQGARDFGHIQYVAAYKVAYSNDSMNWVEYKDPG
SVDSKIFPGNLDNNSHKKNMFEMPFLARFVRILPVAWHNRITMRVELLGC
Download sequence
Identical sequences M3YWJ1
ENSMPUP00000015701 ENSMPUP00000015701 XP_004763825.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]