SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015743 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015743
Domain Number 1 Region: 402-554
Classification Level Classification E-value
Superfamily TRAF domain-like 5.07e-47
Family MATH domain 0.000000666
Further Details:      
 
Domain Number 2 Region: 105-196
Classification Level Classification E-value
Superfamily TRAF domain-like 2.42e-16
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Domain Number 3 Region: 192-279
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000000177
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 
Domain Number 4 Region: 38-111
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000788
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015743
Domain Number - Region: 363-400
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0445
Family Trimerization domain of TRAF 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015743   Gene: ENSMPUG00000015850   Transcript: ENSMPUT00000015984
Sequence length 558
Comment pep:known scaffold:MusPutFur1.0:GL896953.1:10691907:10736117:1 gene:ENSMPUG00000015850 transcript:ENSMPUT00000015984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSEEQGGVPCGFIRQNSGNSISLDFEPNTEYWFVEQLEERYKCAFCRSVLHNPHQTGC
GHRFCQHCILSLRELNAVPLCPVDKEVIRSQEVFKDNCCKREVLNLYVYCKNAPGCNAKI
ILGRYQDHLQQCLFQAVQCSNENCQEQVLRKDLKEHLSARCHFREEKCLYCKKDVVVINL
QYHEENLCPEYPVSCPNKCLQIFPRTEVDEHLAVCPEAEQDCPFKHYGCTVKDKRGILQE
HEHSALRDHMLLVLEKNFQLEEQISDLYKSLEQKESKIQQLAETVKKFEKEFKQFAQLFG
KNGSFLSNIQALSSHIDKSAWLEAQVRQLLQMANQQQSKFDLRALVEAIDTVKQKITLLE
TNDQRLVVLEGETSKHDAHINIHKAQLNKNEERFKLLEGACYNGKLIWKVTDYKMKKREA
LDGHTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNHIMETFKADPSSSSFKRPDGEMNIASGCPRFVAHSTLENAKNTYIK
DDTMFLKVAVDLTDLEDL
Download sequence
Identical sequences M3YWN3
XP_004756906.1.14098 XP_004756907.1.14098 XP_012913912.1.14098 ENSMPUP00000015743 ENSMPUP00000015743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]