SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015765 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015765
Domain Number 1 Region: 22-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.66e-49
Family Hypothetical protein AT3g04780/F7O18 27 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015765   Gene: ENSMPUG00000015871   Transcript: ENSMPUT00000016006
Sequence length 211
Comment pep:known scaffold:MusPutFur1.0:GL896903.1:22247262:22253168:-1 gene:ENSMPUG00000015871 transcript:ENSMPUT00000016006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEE
RTDRSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTD
REPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELR
RHEVTICNYEASANPADHRVHQVTPQTHFIS
Download sequence
Identical sequences L5JUI0 M3YWQ5
ENSMPUP00000015765 ENSPVAP00000012847 ENSPVAP00000012847 ENSMPUP00000015765 XP_004320310.2.83887 XP_004741252.2.14098 XP_006924506.1.64745 XP_011355887.1.92234 XP_015982250.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]