SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015812 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015812
Domain Number 1 Region: 140-383
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-66
Family Nuclear receptor ligand-binding domain 0.00000609
Further Details:      
 
Domain Number 2 Region: 58-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-28
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015812   Gene: ENSMPUG00000015918   Transcript: ENSMPUT00000016053
Sequence length 397
Comment pep:novel scaffold:MusPutFur1.0:GL896974.1:6849318:6858776:1 gene:ENSMPUG00000015918 transcript:ENSMPUT00000016053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVTGGWGGPGSGGGGDTNGVDKAGGYPRAAEEDSASPPGAASDAEPGDEERPGLQVDC
VVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKC
FRVGMRKEGFSLAPGRRNPISHSHRQTSQLSSSSTLCFVFVQAYLSLLRFAQKTPPQRSP
PGYSSPSSFICIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNA
AQCSMPLHVAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKA
IALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASL
ISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Download sequence
Identical sequences M3YWV2
ENSMPUP00000015812 ENSMPUP00000015812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]