SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015822 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015822
Domain Number 1 Region: 22-163
Classification Level Classification E-value
Superfamily EF-hand 2.55e-35
Family Calmodulin-like 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015822   Gene: ENSMPUG00000015928   Transcript: ENSMPUT00000016063
Sequence length 167
Comment pep:novel scaffold:MusPutFur1.0:GL896979.1:1061872:1084522:-1 gene:ENSMPUG00000015928 transcript:ENSMPUT00000016063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRARKRAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRI
NVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFI
KEKLMTQADRFSEDEVKQMFAAFPPDACGNLDYQNLCYVITHGEEKD
Download sequence
Identical sequences M3YWW2
XP_004761656.1.14098 ENSMPUP00000015822 ENSMPUP00000015822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]