SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015828 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015828
Domain Number 1 Region: 819-1105
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-82
Family Protein kinases, catalytic subunit 0.0000000000425
Further Details:      
 
Domain Number 2 Region: 632-734
Classification Level Classification E-value
Superfamily Fibronectin type III 2.33e-17
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 445-636
Classification Level Classification E-value
Superfamily Fibronectin type III 6.94e-16
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 4 Region: 370-448
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000233
Family I set domains 0.039
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015828
Domain Number - Region: 132-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00837
Family I set domains 0.093
Further Details:      
 
Domain Number - Region: 223-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00909
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015828   Gene: ENSMPUG00000015934   Transcript: ENSMPUT00000016069
Sequence length 1124
Comment pep:novel scaffold:MusPutFur1.0:GL896980.1:1735997:1831412:-1 gene:ENSMPUG00000015934 transcript:ENSMPUT00000016069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLAGLVLCGVSLLLSGTVDSAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDMTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNRVCTECKNNGVCHEDTGEC
ICPPGFMGKTCEKACELHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWQGLQCNE
ACQPGYYGPDCRLSCRCTHGELCDRFQGCLCSPERQGLQCEKEGTPRMIPKIEDLPDHIE
VNSGKFNPICKASGWPLPANEEMTLVKPDGTVLHPKDFNLTSHLSVATFTIHRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPEPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWRHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLILLPKSQTTLNLTWQPIFPISEDDFYVEVERRSVQMNSDQQNIKVPGNLTS
VLLNNLHPREQYIVRARVNTKAQGEWSEDLIAWTLSDILPPQPENIRISNITDSTAMISW
TILDGYSISSIIIRYKVQGKNEDQHIDVKIKNATITQYQLKGLEPETAYQVDIFAENNIG
SSNPTFSHELMTLPKSQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIMLQLKRANVQR
RMAQAFQNREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPY
ERPSFAQILVSLNRMLEERKTYVNTTLYEKFAYAGIDCSAEEAA
Download sequence
Identical sequences M3YWW8
ENSMPUP00000015828 XP_004761837.1.14098 ENSMPUP00000015828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]