SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015979 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015979
Domain Number 1 Region: 310-596
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.21e-53
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 32-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000405
Family LIM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 90-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000214
Family LIM domain 0.0046
Further Details:      
 
Domain Number 4 Region: 140-240
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000486
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 3-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000553
Family LIM domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015979   Gene: ENSMPUG00000016086   Transcript: ENSMPUT00000016223
Sequence length 626
Comment pep:novel scaffold:MusPutFur1.0:GL896979.1:2950821:2974192:1 gene:ENSMPUG00000016086 transcript:ENSMPUT00000016223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SELPVCASCGQRIYDGQYLQALSADWHADCFRCCECSAPLSHQYYEKDGQLFCKRDYWAR
YGESCHGCSEHITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYY
QTVVTPVIEQILPDSPGSRLPHTVTLVSIPASAHGRRGLSVSIDPPHGPPGCSTEHSHTV
RVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPH
DTLGHGPGPEPSPLSSPTPTPSGEVGSSTRQKPVLRSYSIDRSPGAGSLSSPASQRKDLG
RSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQR
TFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMVCGWAWSRPAS
QRLGGGGHALKDINLEKETLHPTRCLLNENKNVVVADFGLARLMVEEKTQPADLRSLKKP
DRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGL
NVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFGKLEQWLETLRMHLAGHLPLGPQL
EQLDKGFWETYRRGESGLPAHPEVPD
Download sequence
Identical sequences M3YXB9
ENSMPUP00000015979 ENSMPUP00000015979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]