SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016162 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016162
Domain Number 1 Region: 287-480
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00000181
Further Details:      
 
Domain Number 2 Region: 113-253
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.44e-27
Family CRAL/TRIO domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016162   Gene: ENSMPUG00000016266   Transcript: ENSMPUT00000016406
Sequence length 499
Comment pep:novel scaffold:MusPutFur1.0:GL897060.1:1113425:1155811:-1 gene:ENSMPUG00000016266 transcript:ENSMPUT00000016406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRKKQAGHMKAFPSFLEPSRVLCVPCPWVLCASPSGCWKEPMPESPRGGVGTVCLGRP
AQQQSMSQLDLEELAEIELQRDEEEAAALSIVRKPSAAPAAAQDSALSMNHPFYDVARHG
ILQVAGEDRFGRRVITFSCCRMPPSHELNHRRLLEYLKYTLDQYVESDYTVVYFHYGLNS
RNKPSLGWLQSAYKEFDRRYKKNLKALYVVHPTNFIKVLWTIFKPLISHKFGKKVIYLNG
LSELREHLKYDQLIVPPEVLRYDEKLRNLHEGRSPSPAKMPPPRPPLPTQQFGVSLQYLK
DKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVHTIREIQRLYNQGKPVNFDDYGDI
HVPAVILKTFLRELPQPLLTFRAYEQILGITSVESSLRVTRCRQILQSLPEHNRAVLSYL
MGFLHEVSRECIFNRMNSSNLACVFGLNLIWPSQGASSLSALVPLNLFTELLIEYHEKVF
STPEAPEAHGELSAGTQCR
Download sequence
Identical sequences M3YXV2
ENSMPUP00000016162 XP_004771192.2.14098 ENSMPUP00000016162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]