SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016174 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016174
Domain Number 1 Region: 8-259
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.94e-47
Family Lysophospholipase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016174   Gene: ENSMPUG00000016277   Transcript: ENSMPUT00000016418
Sequence length 433
Comment pep:known scaffold:MusPutFur1.0:GL897060.1:1732936:1749531:-1 gene:ENSMPUG00000016277 transcript:ENSMPUT00000016418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYDPERGWSLSFSGCGFLGFYHVGATRCLSERAPHLVQDARMLFGASAGALHGVALLSGI
SLDIITEILMDIARSARSRKMGIFHPAFNLGRRLRNDLQTYLPDDIHRLISGKMCISLTR
VSDGENVLVSDFHSKEEVVDALLCSSFIPFFCGIIPPSFRGVRYMDGGLSDNVPFFDAKT
TITVSPFYGEYDICPKVKSTNFLHVDMTKLSLRLCSENVYLLIRTLFPADLKVLGEICLR
GYLDAFRFLEENGICNKPHPGLDLPSEEAKTLTFPWGHRNPESGPRVSAEGTKPEGDELL
DHLRLSILPWDERILDNLSPSLTTALNNAIKVKHGQVSRIYDFLPVKVMSYVMLPCTFPM
ESAIAMAQRLVMWLPDMPEDIRWLQWLTCHVCSRVMTQLFPHSRLRTQANGQQPSLRDVK
ALLLSLLSSKSRS
Download sequence
Identical sequences M3YXW4
ENSMPUP00000016174 XP_004771217.1.14098 ENSMPUP00000016174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]